PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G001608.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 177aa    MW: 19140.7 Da    PI: 7.4639
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G001608.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.65e-449105197
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +C aCk+lrrkC+++Cv+apyfpa+qp+kfanvhk+FGasn +kll++l++++reda++sl+yeA++r+rdPvyG++gvi+ lq+ql+q
  HL.SW.v1.0.G001608.1   9 PCGACKLLRRKCQPECVFAPYFPADQPQKFANVHKVFGASNTTKLLNELQPSQREDAVNSLAYEADIRLRDPVYGCAGVITLLQHQLRQ 97 
                           7**************************************************************************************** PP

                DUF260  90 lkaelall 97 
                           l+ el+ +
  HL.SW.v1.0.G001608.1  98 LQMELSCT 105
                           ****9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.3988109IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-439104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MGSSSSNSPC GACKLLRRKC QPECVFAPYF PADQPQKFAN VHKVFGASNT TKLLNELQPS  60
QREDAVNSLA YEADIRLRDP VYGCAGVITL LQHQLRQLQM ELSCTISELS MYQKYLGITQ  120
HGLTVSPHQN LISGAAAAQQ MITYVYDASS LQGMDVSATA GIGQQSRDGQ GLPPHH*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266137.11e-70PREDICTED: LOB domain-containing protein 6
RefseqXP_010646844.11e-70PREDICTED: LOB domain-containing protein 6
RefseqXP_010646845.11e-70PREDICTED: LOB domain-containing protein 6
RefseqXP_010646846.11e-70PREDICTED: LOB domain-containing protein 6
SwissprotO044797e-62LBD6_ARATH; LOB domain-containing protein 6
TrEMBLD7SSJ32e-70D7SSJ3_VITVI; Putative uncharacterized protein
STRINGVIT_00s0340g00090.t014e-70(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96253043
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.44e-63LBD family protein